Enzo ALX-210-744-C200 TRAIL-R3 (human) polyclonal antibody (200 µg)

TRAIL receptor 3, DcR1, Death Receptor 1, TRID, CD263, TNFRSF 10C, TNF-related apoptosis-inducing ligand receptor 3, Tumor necrosis factor receptor superfamily member 10C

Flow Cytometry, ICC, IHC (PS), WB

Detects a band of ~33kDa by Western blot.

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

8794 (Entrez GeneID)

Goat

Synthetic peptide corresponding to aa 33-63 (E33VPQQTVAPQQQRHSFKGEECPAGSHRSEHT63) of the extracellular domain of human TRAIL-R3.

Epitope-affinity purified IgG.

Western blot or Immunocytochemistry on cell lines HEK 293 or Jurkat.

Flow Cytometry (1µl/106 cells/100µl)Immunocytochemistry (1:300),Western Blot (1:1,000)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application.

Human

O14798

This antibody is covered by our Worry-Free Guarantee.

For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles. After opening, prepare aliquots and store at -20°C.

-20°C

Blue Ice