Mfg Part Number
BML-PA1254-0100
Enzo BML-PA1254-0100 Peptide tyrosine tyrosine polyclonal antibody (100 µl)
Quick Overview
Enzo BML-PA1254-0100 Peptide tyrosine tyrosine polyclonal antibody (100 µl)
$504.40
Order will ship within 1-3 business days
| Alternative Name | Peptide YY, PYY |
|---|---|
| Application | IHC, WB |
| Formulation | Liquid. Antiserum containing 10mM sodium azide. |
| Host | Rabbit |
| Immunogen | Natural pig PYY (peptide with tyrosine; HYPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2.). |
| Recommendation Dilutions/Conditions | Western Blot (1:1,000, ECL)Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined individually for each application. |
| Source | Whole rabbit serum. |
| Species Reactivity | Species independent |
| Specificity | Recognizes PYY in a wide range of species. |
| UniProt ID | P68005 |
| Worry-free Guarantee | This antibody is covered by our Worry-Free Guarantee. |
| Handling | Avoid freeze/thaw cycles. |
| Long Term Storage | -20°C |
| Shipping | Blue Ice |
| Brand | Enzo |
|---|---|
| UNSPSC | 12352203 |