Mfg Part Number
Ab00954-7.4

Vector Labs Ab00954-7.4 Anti-ZP2 [IE3], Rat IgG2a, Fc Silent™, kappa (200 μg)

Quick Overview
Osbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas.
$517.40
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:IE3
Heavy Chain Modification:Fc Silent™
Synonyms:Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; ZP-2; Zp2; Zp-2; Zona pellucida protein A
Amount:200 μg
Application Codes Clone:WB; IP; IF; IHC; NTRL
Shipping Temperature:Wet Ice
Origin Pub PMID:26439332
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG2a
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement:IE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These glycoproteins act as receptors for sperm and this recognition serves as a critical step of fertilisation.
Application Notes:IE3 was shown to react with ZP2 by immunoprecipitation and immunofluorescence staining of various mouse tissue sections (East & Dean, 1984; Avella et al, 2014). IE3 was also shown to neutralise ZP2 activity in vivo by causing transient infertility in female mice.
More Information
Brand Vector Labs
UNSPSC 12161500