Mfg Part Number
Ab00954-7.4
Vector Labs Ab00954-7.4 Anti-ZP2 [IE3], Rat IgG2a, Fc Silent™, kappa (200 μg)
Quick Overview
Osbourne-Mendel rats were immunised with solubilised zonae pellucidae from DBA/2 mice. Splenocytes were obtained from immunised rats and fused with the SP2/2 murine myeloma cell line to generate hybridomas.
$517.40
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | IE3 |
| Heavy Chain Modification: | Fc Silent™ |
| Synonyms: | Zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; ZP-2; Zp2; Zp-2; Zona pellucida protein A |
| Amount: | 200 μg |
| Application Codes Clone: | WB; IP; IF; IHC; NTRL |
| Shipping Temperature: | Wet Ice |
| Origin Pub PMID: | 26439332 |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | IgG2a |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Specificity Statement: | IE3 reacts specifically with ZP2 (East & Dean, 1984), where the specific epitope (TIKVVGGYQVNIRVGDTTTDVRYKDDMYHFFC) is at the N-terminus. ZP2 is a glycoprotein which forms the zona pellucida, an extracellular matrix surrounding mammalian oocytes. These glycoproteins act as receptors for sperm and this recognition serves as a critical step of fertilisation. |
| Application Notes: | IE3 was shown to react with ZP2 by immunoprecipitation and immunofluorescence staining of various mouse tissue sections (East & Dean, 1984; Avella et al, 2014). IE3 was also shown to neutralise ZP2 activity in vivo by causing transient infertility in female mice. |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |