Mfg Part Number
Ab02165-23.0
Vector Labs Ab02165-23.0 Anti-SUR1 [N289/16], Rabbit IgG, kappa (200 μg)
Quick Overview
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
$517.40
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | N289/16 |
| Synonyms: | N289/16R; ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; Abcc8 |
| Amount: | 200 μg |
| Application Codes Clone: | WB |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | IgG2a |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | This antibody is specific for the SUR1 protein. It does not cross-react with SUR2B. SUR1 is a subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K+ channels and insulin release. |
| Application Notes: | The IgG1 antibody was used for western blotting on CA1S cells (Bruin et al, 2014; PMID:24257076). Immunofluorescense was preformed with the IgG1 version of this antibody on HeLa cells (Karnik et al, 2013; PMID:24392021). The IgG1 version of this antibody was used to preform western blot on COS6m cells (Li et al, 2013; PMID:23798684). |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |