Mfg Part Number
Ab02165-8.4

Vector Labs Ab02165-8.4 Anti-SUR1 [N289/16], Rat IgG2b, Fc Silent™, kappa (200 μg)

Quick Overview
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1548-1582 (LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK, cytoplasmic C-terminus) of rat SUR1.
$517.40
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:N289/16
Heavy Chain Modification:Fc Silent™
Synonyms:N289/16R; ATP-binding cassette sub-family C member 8; Sulfonylurea receptor 1; Abcc8
Amount:200 μg
Application Codes Clone:WB
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG2a
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:This antibody is specific for the SUR1 protein. It does not cross-react with SUR2B. SUR1 is a subunit of the beta-cell ATP-sensitive potassium channel (KATP). Regulator of ATP-sensitive K+ channels and insulin release.
Application Notes:The IgG1 antibody was used for western blotting on CA1S cells (Bruin et al, 2014; PMID:24257076). Immunofluorescense was preformed with the IgG1 version of this antibody on HeLa cells (Karnik et al, 2013; PMID:24392021). The IgG1 version of this antibody was used to preform western blot on COS6m cells (Li et al, 2013; PMID:23798684).
More Information
Brand Vector Labs
UNSPSC 12161500