Mfg Part Number
Ab02169-23.0

Vector Labs Ab02169-23.0 Anti-SUR2B [N323B/20], Rabbit IgG, kappa (200 μg)

Quick Overview
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
$517.40
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:N323B/20
Synonyms:N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2
Amount:200 μg
Application Codes Clone:ICC; IHC; WB
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG2a
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:This antibody is specific for the SUR2B protein and does not cross react with SUR1. SUR2B is a subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.
Application Notes:This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot.
More Information
Brand Vector Labs
UNSPSC 12161500