Mfg Part Number
Ab02169-8.1
Vector Labs Ab02169-8.1 Anti-SUR2B [N323B/20], Rat IgG2b, kappa (200 μg)
Quick Overview
This antibody was raised by immunising BALB/c mice with a fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRA DM, cytoplasmic C-terminus) of rat SUR2B.
$517.40
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | N323B/20 |
| Synonyms: | N323B/20R; ATP-binding cassette sub-family C member 9; Abcc9; Sulfonylurea receptor 2 |
| Amount: | 200 μg |
| Application Codes Clone: | ICC; IHC; WB |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | IgG2a |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This chimeric rat antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | This antibody is specific for the SUR2B protein and does not cross react with SUR1. SUR2B is a subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with KCNJ11. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation. |
| Application Notes: | This antibody is recommended for detection and analysis of SUR2B by immunocytochemistry, immunohistochemistry and western blot. |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |