Mfg Part Number
Ab02179-2.3

Vector Labs Ab02179-2.3 Anti-SVOP [N356/23], Mouse IgG2a, Fc Silent™, kappa (200 μg)

Quick Overview
This antibody was raised by immunising BALB/c mice with SVOP epitope: amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP
$517.40
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:N356/23
Heavy Chain Modification:Fc Silent™
Synonyms:N356/23R; Synaptic vesicle 2-related protein; SV2-related protein
Amount:200 μg
Application Codes Clone:WB; ICC
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG2a
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement:This antibody is specific for SVOP epitope: amino acids 1-85. The antibody does not cross-react with SVOPL/SVOP2. SVOP has transmembrane transporter activity.
Application Notes:This antibody is recommended for detection and analysis of SVOP by western blot and immunocytochemistry. For instance, the mouse version of this antibody was used to detect SVOP by western blot in adult rat brain membranes and membranes from SVOP knockout and wild-type mice.
More Information
Brand Vector Labs
UNSPSC 12161500