Mfg Part Number
Ab02208-1.1
Vector Labs Ab02208-1.1 Anti-Strep-Tag II [C23.21], Mouse IgG1, kappa (200 μg)
Quick Overview
The original antibody was generated by immunizing BALB/c mice with recombinant ectodomain of glycoprotein E2 of GB virus, containing a double Strep-Tag of amino acid sequence 'AGWSHPQFEKGGGSGGGSGGGSWSHPQFEK'.
$517.40
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | C23.21 |
| Synonyms: | Streptavidin; 'WSHPQFEK'; strep-tag |
| Amount: | 200 μg |
| Application Codes Clone: | ELISA; WB |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | IgG1 |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Specificity Statement: | This antibody recognizes an antigen with amino acid sequence 'WSHPQFEK' present in the Strep Tag with a dissociation constant of 1.4x10^-10M. It recognizes another fusion protein namely VHH-E9 containing the strep-tag sequence of 'LESAWSHPQFEK' at the C terminus with a dissociation constant of 9.1x10^-10M. |
| Application Notes: | This high affinity antibody can detect the strep-tag II fusion proteins in ELISA and western blot assay. This antibody is recommended for strep-tag recognition in fusion proteins through western blotting or immunohistochemistry methods, or to immobilize strep-tagged fusion proteins on Biacore sensor chips for performing Surface Plasmon Resonance (SPR)-mediated protein interaction studies. It can also be used for the purification of strep-tagged recombinant proteins using an affinity column or immunoprecipitation meothod. |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |