Mfg Part Number
Ab02208-10.0

Vector Labs Ab02208-10.0 Anti-Strep-Tag II [C23.21], Human IgG1, kappa (200 μg)

Quick Overview
The original antibody was generated by immunizing BALB/c mice with recombinant ectodomain of glycoprotein E2 of GB virus, containing a double Strep-Tag of amino acid sequence 'AGWSHPQFEKGGGSGGGSGGGSWSHPQFEK'.
$517.40
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:C23.21
Synonyms:Streptavidin; 'WSHPQFEK'; strep-tag
Amount:200 μg
Application Codes Clone:ELISA; WB
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG1
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:This antibody recognizes an antigen with amino acid sequence 'WSHPQFEK' present in the Strep Tag with a dissociation constant of 1.4x10^-10M. It recognizes another fusion protein namely VHH-E9 containing the strep-tag sequence of 'LESAWSHPQFEK' at the C terminus with a dissociation constant of 9.1x10^-10M.
Application Notes:This high affinity antibody can detect the strep-tag II fusion proteins in ELISA and western blot assay. This antibody is recommended for strep-tag recognition in fusion proteins through western blotting or immunohistochemistry methods, or to immobilize strep-tagged fusion proteins on Biacore sensor chips for performing Surface Plasmon Resonance (SPR)-mediated protein interaction studies. It can also be used for the purification of strep-tagged recombinant proteins using an affinity column or immunoprecipitation meothod.
More Information
Brand Vector Labs
UNSPSC 12161500