JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Skip to the beginning of the images gallery

Mfg Part Number

Ab03010-3.0

Vector Labs Ab03010-3.0 Anti-ROS1 [ROS1-5F2], Mouse IgG2b, kappa (200 μg)

VECTOR LABS

Be the first to review this product

Quick Overview

The original antibody was generated by immunizing mice intramuscularly with purified peptide 'GGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDYTSPRIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL' and immune enhancer PEI in a ratio of 1:3 and dissolved in a serum free and dual-antibody-free DMEM solution. The purified peptide is identified as a specific binding fragment of PF-06463922 (Crizotinib, Xalkori).

$517.40

Order will ship within 1-3 business days

Description

Product Class: Purified
Clone ID: ROS1-5F2
Synonyms: MCF3, ROS; Proto-oncogene tyrosine-protein kinase ROS; Proto-oncogene c-Ros; Proto-oncogene c-Ros-1; Receptor tyrosine kinase c-ros oncogene 1; c-Ros receptor tyrosine kinase
Amount: 200 μg
Application Codes Clone: ELISA; WB
Shipping Temperature: Wet Ice
Buffer Composition: PBS with 0.02% Proclin 300.
Original Format: IgG2b
Storage Temperature: Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement: This antibody binds ROS1 kinase domain. Mutations, rearrangements, and overexpression of the ROS1 gene can all lead to the imbalance of the ROS1 kinase protein, and the abnormal ROS1 protein kinase activity activates multiple downstream oncogenic signal pathways, including PI3K/AKT/mTOR, STAT3, RAS-MAPK/ERK, VAV3 and SHP-1/2 etc.
Application Notes: The binding specificity of this antibody for ROS1 was determined using ELISA. This antibody was also capable of detection the ROS1 kinase domain polypeptide in a western blot assay. The original IgG2b version of this antibody was capable of binding the antigen with a high affinity and the dissociation constant reaches Kd=3.56×10-11M. The affinity measurement was done using surface plasmon resonance. This antibody showed a good inhibitory effect on hepatocellular carcinoma cells (HepG2) in a CCK-8 cytotoxicity test (CN111440241).

Product Class:	Purified
Clone ID:	ROS1-5F2
Synonyms:	MCF3, ROS; Proto-oncogene tyrosine-protein kinase ROS; Proto-oncogene c-Ros; Proto-oncogene c-Ros-1; Receptor tyrosine kinase c-ros oncogene 1; c-Ros receptor tyrosine kinase
Amount:	200 μg
Application Codes Clone:	ELISA; WB
Shipping Temperature:	Wet Ice
Buffer Composition:	PBS with 0.02% Proclin 300.
Original Format:	IgG2b
Storage Temperature:	Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement:	This antibody binds ROS1 kinase domain. Mutations, rearrangements, and overexpression of the ROS1 gene can all lead to the imbalance of the ROS1 kinase protein, and the abnormal ROS1 protein kinase activity activates multiple downstream oncogenic signal pathways, including PI3K/AKT/mTOR, STAT3, RAS-MAPK/ERK, VAV3 and SHP-1/2 etc.
Application Notes:	The binding specificity of this antibody for ROS1 was determined using ELISA. This antibody was also capable of detection the ROS1 kinase domain polypeptide in a western blot assay. The original IgG2b version of this antibody was capable of binding the antigen with a high affinity and the dissociation constant reaches Kd=3.56×10-11M. The affinity measurement was done using surface plasmon resonance. This antibody showed a good inhibitory effect on hepatocellular carcinoma cells (HepG2) in a CCK-8 cytotoxicity test (CN111440241).

Specifications

More Information
Brand	Vector Labs
UNSPSC	12161500

Reviews