JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Skip to the beginning of the images gallery

Mfg Part Number

Ab03208-30.11

Vector Labs Ab03208-30.11 Anti-Bet v 1 [H3-1], scFv fragment (His), ScFv, (50 μg)

VECTOR LABS

Be the first to review this product

Quick Overview

The original antibody was isolated from a phage‐displayed combinatorial single‐chain fragment (ScFv) library generated from the peripheral blood mononuclear cells of an immunized subject and screened for Bet v 1‐reactive antibody fragments.

$692.90

Order will ship within 1-3 business days

Description

Product Class: Purified
Clone ID: H3-1
Heavy Chain Modification: ScFv
Synonyms: BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1
Amount: 50 μg
Application Codes Clone: ELISA;
Shipping Temperature: Wet Ice
Origin Pub PMID: 29315611
Buffer Composition: PBS with 0.02% Proclin 300.
Original Format: scFv
Storage Temperature: Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement: This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1‐related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C‐terminal F2 domain of Bet v 1 (amino acids 130‐160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synthetic, unfolded peptide derived from the C‐terminus of Bet v 1.
Application Notes: The reactivity of this antibody to Bet v 1 and related allergens Aln g 1, Cor a 1, Mal d 1 was determined using ELISA. This antibody reacted best with rBet v 1 but also with the cross‐reactive allergens from alder (Aln g 1), hazel (Cor a 1), and apple (Mal d 1). The original scFv version of this antibody binds Bet v 1, Aln g 1, Cor a 1, and Mal d 1 with a binding affinity of Bet v 1: KD= 6.22 × 10−10 M, Mal d 1: KD= 2.57 × 10−9 M, Aln g 1: KD= 2.96 × 10−9 M and Cor a 1: KD= 6.83 × 10−9 M respectively (PMID: 29315611). This antibody inhibited allergic patients’ polyclonal IgE binding to Bet v 1, and partially suppressed allergen‐induced basophil activation (PMID: 29315611).

Product Class:	Purified
Clone ID:	H3-1
Heavy Chain Modification:	ScFv
Synonyms:	BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1
Amount:	50 μg
Application Codes Clone:	ELISA;
Shipping Temperature:	Wet Ice
Origin Pub PMID:	29315611
Buffer Composition:	PBS with 0.02% Proclin 300.
Original Format:	scFv
Storage Temperature:	Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement:	This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1‐related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C‐terminal F2 domain of Bet v 1 (amino acids 130‐160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synthetic, unfolded peptide derived from the C‐terminus of Bet v 1.
Application Notes:	The reactivity of this antibody to Bet v 1 and related allergens Aln g 1, Cor a 1, Mal d 1 was determined using ELISA. This antibody reacted best with rBet v 1 but also with the cross‐reactive allergens from alder (Aln g 1), hazel (Cor a 1), and apple (Mal d 1). The original scFv version of this antibody binds Bet v 1, Aln g 1, Cor a 1, and Mal d 1 with a binding affinity of Bet v 1: KD= 6.22 × 10−10 M, Mal d 1: KD= 2.57 × 10−9 M, Aln g 1: KD= 2.96 × 10−9 M and Cor a 1: KD= 6.83 × 10−9 M respectively (PMID: 29315611). This antibody inhibited allergic patients’ polyclonal IgE binding to Bet v 1, and partially suppressed allergen‐induced basophil activation (PMID: 29315611).

Specifications

More Information
Brand	Vector Labs
UNSPSC	12161500

Reviews