Mfg Part Number
Ab03208-30.11-BS
Vector Labs Ab03208-30.11-BS Anti-Bet v 1 [H3-1], scFv fragment (His), ScFv, (1 mg)
Quick Overview
The original antibody was isolated from a phage‐displayed combinatorial single‐chain fragment (ScFv) library generated from the peripheral blood mononuclear cells of an immunized subject and screened for Bet v 1‐reactive antibody fragments.
$4,938.70
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | H3-1 |
| Heavy Chain Modification: | ScFv |
| Synonyms: | BETVIA; BETVI; Major pollen allergen Bet v 1-A; Allergen Bet v 1-A; ALNGI; Major pollen allergen Aln g 1; Allergen Aln g I; CORAI; Major pollen allergen Cor a 1; Allergen Cor a I; MALDI; MALD1; Major allergen Mal d 1 |
| Amount: | 1 mg |
| Application Codes Clone: | ELISA; |
| Shipping Temperature: | Wet Ice |
| Origin Pub PMID: | 29315611 |
| Buffer Composition: | PBS only. |
| Original Format: | scFv |
| Storage Temperature: | Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For longer storage, aliquot and store at -20⁰C. |
| Specificity Statement: | This antibody reacts with native Bet v 1 and homologous allergens. This antibody can also bind Bet v 1‐related allergens namely Aln g 1, Cor a 1, Mal d 1. This antibody specifically binds C‐terminal F2 domain of Bet v 1 (amino acids 130‐160) and the binding epitope comprises the amino acid sequence 'KAEQVKASKEMGETLLRAVESYLLAHSDAYN'. This antibody recognized not only folded Bet v 1 but also a synthetic, unfolded peptide derived from the C‐terminus of Bet v 1. |
| Application Notes: | The reactivity of this antibody to Bet v 1 and related allergens Aln g 1, Cor a 1, Mal d 1 was determined using ELISA. This antibody reacted best with rBet v 1 but also with the cross‐reactive allergens from alder (Aln g 1), hazel (Cor a 1), and apple (Mal d 1). The original scFv version of this antibody binds Bet v 1, Aln g 1, Cor a 1, and Mal d 1 with a binding affinity of Bet v 1: KD= 6.22 × 10−10 M, Mal d 1: KD= 2.57 × 10−9 M, Aln g 1: KD= 2.96 × 10−9 M and Cor a 1: KD= 6.83 × 10−9 M respectively (PMID: 29315611). This antibody inhibited allergic patients’ polyclonal IgE binding to Bet v 1, and partially suppressed allergen‐induced basophil activation (PMID: 29315611). |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |