Mfg Part Number
Ab03979-23.0

Vector Labs Ab03979-23.0 Anti-ApoA1 [D11-6], Rabbit IgG, kappa (100 μg)

Quick Overview
The original antibody was generated by immunizing BALB/c mice with human ApoA1.
$570.70
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:D11-6
Synonyms:Apo-AI; ApoA-I; Apolipoprotein A-I; Apolipoprotein A1
Amount:100 μg
Application Codes Clone:ELISA
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG2a
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:The antibody is specific for ApoA1. The antibody recognizes the epitope exposed by the ApoA1 protein on an HDL subclass significantly positively correlated with CHD, and the recognition epitope is determined on a polypeptide sequence comprising 41 amino acids (LGEEMRDRRAHVDALRTHLAPYSDELRQRLAARLEALKEN). The antibody does not react with HSA and the recombinant protein SAA1. Apolipoprotein A1 (ApoA1) is the main structural protein of high-density lipoprotein (HDL), and its physiological function is to help HDL capture free cholesterol.
Application Notes:The specificity of the antibody for ApoA1 protein was confirmed by ELISA analysis. The binding affinity of the antibody was 9.6×10^-10 M. The antibody was employed for detection of APOA1. The antibody could identify a possible pathogenic HDL subtype, and the detection result was positively correlated with CHD. Further, the detection results of the kit developed by the antibody had high consistency with the clinical diagnosis results (CN113265002A).
More Information
Brand Vector Labs
UNSPSC 12161500