Mfg Part Number
Ab04113-1.1

Vector Labs Ab04113-1.1 Anti-OPG [AbAb01OPG], Mouse IgG1, kappa (100 μg)

Quick Overview
The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).
$570.70
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:AbAb01OPG
Synonyms:Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor
Amount:100 μg
Application Codes Clone:ELISA
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG1
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Specificity Statement:This antibody is specific for the N-terminal epitope of OPG.
Application Notes:This antibody was generated as a capture antibody that binds to the N-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding detection antibody (AbAb02OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
More Information
Brand Vector Labs
UNSPSC 12161500