Mfg Part Number
Ab04114-23.0
Vector Labs Ab04114-23.0 Anti-OPG [AbAb02OPG], Rabbit IgG, kappa (100 μg)
Quick Overview
The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).
$570.70
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | AbAb02OPG |
| Synonyms: | Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor |
| Amount: | 100 μg |
| Application Codes Clone: | ELISA |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | IgG1 |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | This antibody is specific for the C-terminal epitope of OPG. |
| Application Notes: | This antibody was generated as a detection antibody that binds to the C-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding capture antibody (AbAb01OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A). |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |