Mfg Part Number
Ab04114-23.0

Vector Labs Ab04114-23.0 Anti-OPG [AbAb02OPG], Rabbit IgG, kappa (100 μg)

Quick Overview
The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).
$570.70
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:AbAb02OPG
Synonyms:Osteoprotegerin; OCIF; PDB5; TR1; TNFRSF11B; Tumor necrosis factor receptor superfamily member 11b; TNF receptor superfamily member 11b; Osteoclastogenesis inhibitory factor
Amount:100 μg
Application Codes Clone:ELISA
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG1
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:This antibody is specific for the C-terminal epitope of OPG.
Application Notes:This antibody was generated as a detection antibody that binds to the C-terminal epitope of OPG, as verified by an ELISA. This antibody and the corresponding capture antibody (AbAb01OPG) were used to create an OPG detection kit, which demonstrated a good correlation with a control OPG kit in detecting OPG concentrations in serum samples (CN113621060A).
More Information
Brand Vector Labs
UNSPSC 12161500