Mfg Part Number
Ab04219-10.3

Vector Labs Ab04219-10.3 Anti-Caspase-3 [4F-6], Human IgG1, Fc Silent™, kappa (100 μg)

Quick Overview
The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
$570.70
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:4F-6
Heavy Chain Modification:Fc Silent™
Synonyms:CASP-3; CPP-32; SCA-1; EC:3.4.22.56; Apopain; Cysteine protease CPP32; Protein Yama
Amount:100 μg
Application Codes Clone:ELISA; WB; Inhibition
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG1
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.
Application Notes:The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A).
More Information
Brand Vector Labs
UNSPSC 12161500