Mfg Part Number
Ab04219-23.0
Vector Labs Ab04219-23.0 Anti-Caspase-3 [4F-6], Rabbit IgG, kappa (100 μg)
Quick Overview
The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.
$570.70
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | 4F-6 |
| Synonyms: | CASP-3; CPP-32; SCA-1; EC:3.4.22.56; Apopain; Cysteine protease CPP32; Protein Yama |
| Amount: | 100 μg |
| Application Codes Clone: | ELISA; WB; Inhibition |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | IgG1 |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA. |
| Application Notes: | The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A). |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |