Mfg Part Number
Ab04482-23.0
Vector Labs Ab04482-23.0 Anti-Envelopment polyprotein [RV-Gn3], Rabbit IgG, kappa (100 μg)
Quick Overview
The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.
$570.70
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | RV-Gn3 |
| Synonyms: | GP; Gn; Glycoprotein N; M polyprotein |
| Amount: | 100 μg |
| Application Codes Clone: | ELISA; neutralization; crystallography |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | Fab |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This reformatted rabbit antibody was made using the variable domain sequences of the original Rabbit Fab format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus. |
| Application Notes: | The original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046). |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |