Mfg Part Number
Ab04482-23.0

Vector Labs Ab04482-23.0 Anti-Envelopment polyprotein [RV-Gn3], Rabbit IgG, kappa (100 μg)

Quick Overview
The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.
$570.70
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:RV-Gn3
Synonyms:GP; Gn; Glycoprotein N; M polyprotein
Amount:100 μg
Application Codes Clone:ELISA; neutralization; crystallography
Shipping Temperature:Wet Ice
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:Fab
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This reformatted rabbit antibody was made using the variable domain sequences of the original Rabbit Fab format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.
Application Notes:The original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046).
More Information
Brand Vector Labs
UNSPSC 12161500