Mfg Part Number
Ab04495-10.29

Vector Labs Ab04495-10.29 Anti-gB [1G2], Human Fab fragment, His-Tagged, lambda (100 μg)

Quick Overview
The original antibody was isolated from EBV transformed human peripheral blood derived B cells derived from hCMV-infected donors.
$692.90
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:1G2
Heavy Chain Modification:His-Tagged
Synonyms:Envelope glycoprotein B; UL55; Ab-50
Amount:100 μg
Application Codes Clone:ELISA; Crystallography; in vitro; neutralization; SPR; FC; FACS; IP
Shipping Temperature:Wet Ice
Origin Pub PMID:26365435
Buffer Composition:PBS with 0.02% Proclin 300.
Original Format:IgG3
Storage Temperature:Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C.
Chimeric Use Statement:This reformatted human antibody was made using the variable domain sequences of the original Human IgG3 format, for improved compatibility with existing reagents, assays and techniques.
Specificity Statement:This antibody is specific for a surface epitope in antigenic domain 5 (AD-5), also termed Domain I (Dom I), of Human cytomegalovirus (hCMV) (strain Towne), also called Human herpesvirus 5 (HHV-5). Dom I resides between amino acid residues 133 to 343 of the gB of hCMV strain AD169 and has the following sequence: IVAHTFKVRVYQKVLTFRRSYAYIYTTYLLGSNTEYVAPPMWEIHHINKFAQCYSSYSRVIG
GTVFVAYHRDSYENKTMQLIPDDYSNTHSTRYVTVKDQWHSRGSTWLYRETCNLNCMLT
ITTARSKYPYHFFATSTGDVVYISPFYNGTNRNASYFGENADKFFIFPNYTIVSDFGRPNAA
PETHRLVAFLERADSVISWDIQDEKNVT. The exact epitope lies between Tyr280-Phe300, or: Y-NGTNRNASYFGENADKFFIF-P.
Application Notes:The original version of the antibody was used in a neutralization assay against human cytomegalovirus (hCMV). It was found to neutralize hCMV with high potency — it neutralized the virus with an IC50 of 0.1 μg/ml and an IC90 of 0.4 μg/ml (US9346874B2). The Fab version of this antibody was generated and its structure in complex with hCMV gB was explored using crystallography. It was also used in neutralization assays, surface staining of full-length gB in flow cytometry, and gB immunoprecipitation (Chandramouli et al., 2015; PMID: 26365435).
More Information
Brand Vector Labs
UNSPSC 12161500