Mfg Part Number
Ab04530-34.11-BS

Vector Labs Ab04530-34.11-BS Anti-Phospholipase A2 [AbAb01-PLA2], Camelid VHH, His-tagged, (1 mg)

Quick Overview
A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generated this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.
$5,162.30
Order will ship within 1-3 business days
Add to Wish List
Product Class:Purified
Clone ID:AbAb01-PLA2
Heavy Chain Modification:His-tagged
Synonyms:PLA2; Snake venom phospholipase A2; Phospholipase A2 5
Amount:1 mg
Application Codes Clone:ELISA
Shipping Temperature:Wet Ice
Buffer Composition:PBS only.
Original Format:VHH
Storage Temperature:Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For longer storage, aliquot and store at -20⁰C.
Specificity Statement:This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait).
Application Notes:This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA.
More Information
Brand Vector Labs
UNSPSC 12161500