Mfg Part Number
Ab04531-10.159
Vector Labs Ab04531-10.159 Anti-Phospholipase A2 [AbAb02-PLA2], Human IgG1-Fc Fusion, (100 μg)
Quick Overview
A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.
$570.70
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | AbAb02-PLA2 |
| Synonyms: | PLA2; Snake venom phospholipase A2; Phospholipase A2 5 |
| Amount: | 100 μg |
| Application Codes Clone: | ELISA |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | VHH |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This chimeric human antibody was made using the variable domain sequences of the original Alpaca VHH format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait). |
| Application Notes: | This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA. |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |