Mfg Part Number
Ab04531-34.11-BS
Vector Labs Ab04531-34.11-BS Anti-Phospholipase A2 [AbAb02-PLA2], Camelid VHH, His-tagged, (1 mg)
Quick Overview
A chimeric protein was generated by combining the linear epitopes of three main toxins (phospholipase A2 [PLA2], snake venom metalloproteinase [SVMP] and 3 finger toxin [3FT]) of the snake venoms of Najanajaatra, Ophiophagus hannah and Bungarus fasciatus. The chimeric protein was conjugated with KLH to form the immunogen which was used to immunize alpacas to generate this antibody. The actual sequence of the chimeric protein used for immunization was 'YCGPGGTGTPLDGGCDRAAAICFAAAPYGGKPDITCTGAKGSCGGGGKLTCKADNDECAAFGGSGGTITCNADNDEGGSQGTLTCKGGNNA'.
$5,162.30
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | AbAb02-PLA2 |
| Heavy Chain Modification: | His-tagged |
| Synonyms: | PLA2; Snake venom phospholipase A2; Phospholipase A2 5 |
| Amount: | 1 mg |
| Application Codes Clone: | ELISA |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS only. |
| Original Format: | VHH |
| Storage Temperature: | Store at 4⁰C for up to 3 months. Note, this antibody is provided without added preservatives, it is therefore recommed this antibody be handled under sterile conditions. For longer storage, aliquot and store at -20⁰C. |
| Specificity Statement: | This antibody binds the phospholipase A2 protein found in the venom of Naja naja atra (Chinese cobra), Ophiophagus hannah (King cobra) and Bungarus fasciatus (Banded krait). |
| Application Notes: | This antibody can be used for determination of PLA2 protein from snake venom of coral snakes, cobras and king cobra using ELISA. |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |