Mfg Part Number
Ab04558-23.0
Vector Labs Ab04558-23.0 Anti-Beta-secretase 2 [1/9], Rabbit IgG, kappa (100 μg)
Quick Overview
The original antibody was raised by immunizing Swiss albino mice with human Beta-secretase 2 amino acids 244 to 333.
$570.70
Order will ship within 1-3 business days
| Product Class: | Purified |
|---|---|
| Clone ID: | 1/9 |
| Synonyms: | DRAP; Asp 1; BACE2; AEPLC; ASP21; ALP56; ASP1; CDA13; UNQ418; PRO852; Memapsin-1; Aspartyl protease 1; Aspartic-like protease 56 kDa; Beta-site APP cleaving enzyme 2; Down region aspartic protease; Theta-secretase; Membrane-associated aspartic protease 1; Beta-site amyloid precursor protein cleaving enzyme 2 |
| Amount: | 100 μg |
| Application Codes Clone: | SPR; crystallography; IF |
| Shipping Temperature: | Wet Ice |
| Buffer Composition: | PBS with 0.02% Proclin 300. |
| Original Format: | Fab |
| Storage Temperature: | Store at 4⁰C for up to 3 months. For longer storage, aliquot and store at -20⁰C. |
| Chimeric Use Statement: | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse Fab format, for improved compatibility with existing reagents, assays and techniques. |
| Specificity Statement: | This antibody is specific for the sequence TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYR of human Beta-secretase 2. |
| Application Notes: | The structure of the original antibody was determined using x-ray crystallography. This antibody was used for surface plasmon resonance on Beta-secretase 2 (Banner et al., 2013; PMID:23695257). This antibody was used to stain BACE2 in immunofluorescence on pancreatic human islets (Rechsteiner et al., 2014; PMID:24905913). |
| Brand | Vector Labs |
|---|---|
| UNSPSC | 12161500 |